PMF1 Rabbit Polyclonal Antibody

CAT#: TA329320

Rabbit Polyclonal anti-PMF1 antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PMF1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PMF1 antibody: synthetic peptide directed towards the middle region of human PMF1. Synthetic peptide located within the following region: AAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 23 kDa
Gene Name polyamine-modulated factor 1
Background PMF1 is part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. It may act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
Synonyms Est1p-like protein B (EST1B); OTTHUMP00000016581; polyamine-modulated factor 1
Note Immunogen sequence homology: Goat: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Pig: 92%; Horse: 92%; Guinea pig: 86%; Bovine: 85%; Rabbit: 79%; Dog: 77%
Reference Data
Protein Families Stem cell - Pluripotency

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.