Aryl hydrocarbon Receptor (AHR) Rabbit Polyclonal Antibody

CAT#: TA329363

Rabbit Polyclonal anti-AHR antibody

Product Images

AHR antibody - N-terminal region validated by WB using Human HepG2 Lysate at 2.5ug/ml, 5ug/ml.

• 

  WB Suggested Anti-AHR Antibody Titration: 2.5ug/ml; ELISA Titer: 1:12500; Positive Control: Human Placenta

• 

  Lanes: Lane 1: 50 ug HepG2 nuclei extract + benzo[a]pyrene; Lane 2: 50 ug HepG2 cytoplasm extract + benzo[a]pyrene; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1:1000; Gene Name: AHR (Arylhydrocarbon receptor); Submitted by: Anonymous;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AHR antibody: synthetic peptide directed towards the N terminal of human AHR. Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 96 kDa
• Gene Name: aryl hydrocarbon receptor
• Database Link:
  NP_001612
  Entrez Gene 196 Human
  UniProt ID P35869
• Background: Aryl hydrocarbon receptor (AHR) is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. AHR has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. AHR ligands included a variety of aromatic hydrocarbons.
• Synonyms: bHLHe76
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors