ELF4 Rabbit Polyclonal Antibody

CAT#: TA329366

Rabbit Polyclonal anti-ELF4 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ELF4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the N terminal of human ELF4. Synthetic peptide located within the following region: RKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 71 kDa
Gene Name E74 like ETS transcription factor 4
Background ELF4 is a member of the ETS gene family of transcription factors. ELF4 is involved in inducing cell cycle arrest in naive CD8+ T cells.
Synonyms ELFR; MEF
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%; Rabbit: 93%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.