FGD1 Rabbit Polyclonal Antibody

CAT#: TA329379

Rabbit Polyclonal anti-FGD1 antibody

Product Images

WB Suggested Anti-FGD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Raji cell lysateFGD1 is supported by BioGPS gene expression data to be expressed in Raji

• 

  Rabbit Anti-FGD1 Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FGD1 antibody: synthetic peptide directed towards the C terminal of human FGD1. Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 107 kDa
• Gene Name: FYVE, RhoGEF and PH domain containing 1
• Database Link:
  NP_004454
  Entrez Gene 2245 Human
  UniProt ID P98174
• Background: FGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome.
• Synonyms: AAS; FGDY; MRXS16; ZFYVE3
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Horse: 79%; Rabbit: 79%

Reference Data

• Protein Pathways: Regulation of actin cytoskeleton