FOXC2 Rabbit Polyclonal Antibody

CAT#: TA329393

Rabbit Polyclonal anti-FOXC2 antibody


USD 310.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "FOXC2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FOXC2 antibody: synthetic peptide directed towards the C terminal of human FOXC2. Synthetic peptide located within the following region: PQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 54 kDa
Gene Name forkhead box C2
Background FOXC2 belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues.
Synonyms FKHL14; LD; MFH-1; MFH1
Note Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Bovine: 92%; Pig: 85%; Guinea pig: 85%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.