bcl 6 (BCL6) Rabbit Polyclonal Antibody

CAT#: TA329415

Rabbit Polyclonal anti-BCL6 Antibody

Product Images

Host: Rabbit; Target Name: BCL6; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-BCL6 antibody is: synthetic peptide directed towards the C-terminal region of Human BCL6. Synthetic peptide located within the following region: IHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: B-cell CLL/lymphoma 6
• Database Link:
  NP_001697
  Entrez Gene 604 Human
  UniProt ID P41182
• Background: The function of this protein remains unknown.
• Synonyms: BCL5; BCL6A; LAZ3; ZBTB27; ZNF51
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors