AMCase (CHIA) Rabbit Polyclonal Antibody

CAT#: TA329463

Rabbit Polyclonal anti-CHIA antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CHIA"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the middle region of human CHIA. Synthetic peptide located within the following region: GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name chitinase, acidic
Background CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
Synonyms AMCASE; CHIT2; TSA1902
Note Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Rat: 86%; Horse: 86%
Reference Data
Protein Families Secreted Protein
Protein Pathways Amino sugar and nucleotide sugar metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.