Gjb3 Rabbit Polyclonal Antibody

CAT#: TA329540

Rabbit Polyclonal anti-Gjb3 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Gjb3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Gjb3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name gap junction protein, beta 3
Background One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Synonyms Connexin-31; CX31; DFNA2; DFNA2B; EKV; FLJ22486; MGC102938
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%; Zebrafish: 92%; Dog: 83%; Pig: 83%; Horse: 83%; Human: 83%; Bovine: 79%; Rabbit: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.