Cldn6 Rabbit Polyclonal Antibody

CAT#: TA329545

Rabbit Polyclonal anti-Cldn6 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Cldn6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Cldn6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 23 kDa
Gene Name claudin 6
Background Cldn6 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Synonyms OTTHUMP00000159248
Note Immunogen sequence homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Pig: 88%; Bovine: 88%; Guinea pig: 88%; Horse: 81%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.