Cbfa2t2 Rabbit Polyclonal Antibody

CAT#: TA329599

Rabbit polyclonal anti-Cbfa2t2 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Cbfa2t2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Cbfa2t2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSND
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 66 kDa
Gene Name core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human)
Background Cbfa2t2 may be a transcriptional corepressor.
Synonyms DKFZp313F2116; EHT; MTGR1; OTTHUMP00000030653; p85; ZMYND3
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.