Cbfa2t2 Rabbit Polyclonal Antibody
Other products for "Cbfa2t2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CBFA2T2H antibody: synthetic peptide directed towards the middle region of mouse CBFA2T2H. Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 65 kDa |
Gene Name | core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human) |
Database Link | |
Background | Mouse Cbfa2t2h associates with mSin3A, N-CoR, and histone deacetylase 3 and that when tethered to DNA, it acts as a transcriptional corepressor. |
Synonyms | DKFZp313F2116; EHT; MTGR1; OTTHUMP00000030653; p85; ZMYND3 |
Note | Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Dog: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.