Cbfa2t2 Rabbit Polyclonal Antibody

CAT#: TA329600

Rabbit polyclonal anti-CBFA2T2H antibody

Product Images

WB Suggested Anti-CBFA2T2H Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CBFA2T2H antibody: synthetic peptide directed towards the middle region of mouse CBFA2T2H. Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human)
• Database Link:
  NP_766448
  Entrez Gene 12396 Mouse
  UniProt ID O70374
• Background: Mouse Cbfa2t2h associates with mSin3A, N-CoR, and histone deacetylase 3 and that when tethered to DNA, it acts as a transcriptional corepressor.
• Synonyms: DKFZp313F2116; EHT; MTGR1; OTTHUMP00000030653; p85; ZMYND3
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Dog: 79%