Rbfox2 Rabbit Polyclonal Antibody

CAT#: TA329611

Rabbit polyclonal anti-Rbfox2 Antibody

Product Images

Host: Rabbit; Target Name: Rbfox2; Sample Tissue: NIH-3T3 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rbfox2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rbfox2. Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: RNA binding protein, fox-1 homolog (C. elegans) 2
• Database Link:
  NP_001104297
  Entrez Gene 93686 Mouse
  UniProt ID Q8BP71
• Background: Rbm9 is a RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements.Rbm9 prevents binding of U2AF2 to the 3'-splice site. Rbm9 regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. Rbm9 seems to act as a coregulatory factor of ER-alpha.
• Synonyms: 2810460A15Rik; AA407676; AI118529; Fbm2; Fxh; Hrnbp2; Rbm9
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 79%; Human: 79%