Rbfox2 Rabbit Polyclonal Antibody
Other products for "Rbfox2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Rbfox2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rbfox2. Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 47 kDa |
Gene Name | RNA binding protein, fox-1 homolog (C. elegans) 2 |
Database Link | |
Background | Rbm9 is a RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements.Rbm9 prevents binding of U2AF2 to the 3'-splice site. Rbm9 regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. Rbm9 seems to act as a coregulatory factor of ER-alpha. |
Synonyms | 2810460A15Rik; AA407676; AI118529; Fbm2; Fxh; Hrnbp2; Rbm9 |
Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 79%; Human: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.