E2f7 Rabbit Polyclonal Antibody

CAT#: TA329623

Rabbit polyclonal anti-E2f7 antibody

Product Images

WB Suggested Anti-E2f7 Antibody Titration: 0.2-1 ug/ml; Positive Control: SP2/0 cell lysate

• 

  Mouse stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-E2f7 antibody: synthetic peptide directed towards the N terminal of mouse E2f7. Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 99 kDa
• Gene Name: E2F transcription factor 7
• Database Link:
  NP_848724
  Entrez Gene 144455 HumanEntrez Gene 52679 Mouse
  UniProt ID Q6S7F2
• Background: E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts
• Synonyms: E2F-7; FLJ12981
• Note: Immunogen sequence homology: Mouse: 100%; Bovine: 93%; Pig: 92%; Dog: 86%; Rat: 86%; Human: 86%; Horse: 85%; Rabbit: 79%