Gtf2h3 Rabbit Polyclonal Antibody

CAT#: TA329633

Rabbit polyclonal anti-Gtf2h3 antibody

Product Images

WB Suggested Anti-Gtf2h3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Gtf2h3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: general transcription factor IIH, polypeptide 3
• Database Link:
  NP_852075
  Entrez Gene 209357 Mouse
  UniProt ID Q8VD76
• Background: Gtf2h3 is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Gtf2h3 anchors XPB.
• Synonyms: BTF2; BTF2-p34; TFB4; TFIIH
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%