BMAL1 (ARNTL) Rabbit Polyclonal Antibody
Other products for "ARNTL"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 25 kDa |
Gene Name | aryl hydrocarbon receptor nuclear translocator like |
Database Link | |
Background | ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators. |
Synonyms | bHLHe5; BMAL1; BMAL1c; JAP3; MOP3; PASD3; TIC |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Mouse: 92%; Rabbit: 92% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Circadian rhythm - mammal |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.