BMAL1 (ARNTL) Rabbit Polyclonal Antibody

CAT#: TA329741

Rabbit Polyclonal Anti-ARNTL Antibody

Product Images

WB Suggested Anti-ARNTL Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Skin

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: aryl hydrocarbon receptor nuclear translocator like
• Database Link:
  NP_001169
  Entrez Gene 11865 MouseEntrez Gene 406 Human
  UniProt ID O00327
• Background: ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators.
• Synonyms: bHLHe5; BMAL1; BMAL1c; JAP3; MOP3; PASD3; TIC
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Mouse: 92%; Rabbit: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Circadian rhythm - mammal