SENP5 Rabbit Polyclonal Antibody

CAT#: TA329775

Rabbit polyclonal Anti-SENP5 Antibody

Product Images

WB Suggested Anti-SENP5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate

• 

  Sample Type: 1.Rat Testis cells (200 ug) ; Primary Dilution: 1:1000; Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit; Secondary Dilution: 1:1000

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SENP5 antibody: synthetic peptide directed towards the middle region of human SENP5. Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: SUMO1/sentrin specific peptidase 5
• Database Link:
  NP_689912
  Entrez Gene 303874 RatEntrez Gene 205564 Human
  UniProt ID Q96HI0
• Background: The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.
• Synonyms: DKFZp564O1016; FLJ42398; MGC27076
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protease