CNOT2 Rabbit Polyclonal Antibody

CAT#: TA329883

Rabbit Polyclonal Anti-CNOT2 Antibody

Product Images

WB Suggested Anti-CNOT2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: CCR4-NOT transcription complex subunit 2
• Database Link:
  NP_001186231
  Entrez Gene 4848 Human
  UniProt ID Q9NZN8
• Background: CNOT2 is one of the subunits of the CCR4-NOT complex,which functions as general transcription regulation complex.
• Synonyms: CDC36; HSPC131; NOT2; NOT2H
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: RNA degradation