PAX4 Rabbit Polyclonal Antibody

CAT#: TA329888

Rabbit Polyclonal Anti-PAX4 Antibody

Product Images

WB Suggested Anti-PAX4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: PAX4; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: PAX4; Sample Tissue: OVCAR-3; Antibody Dilution: 1.0ug/ml; PAX4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

• 

  Host: Rabbit; Target Name: PAX4; Sample Tissue: COLO205; Antibody Dilution: 1.0ug/ml; PAX4 is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: paired box 4
• Database Link:
  NP_006184
  Entrez Gene 83630 RatEntrez Gene 5078 Human
• Background: PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.
• Synonyms: KPD; MODY9
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young