Myelin expression factor 2 (MYEF2) Rabbit Polyclonal Antibody

CAT#: TA329889

Rabbit Polyclonal Anti-MYEF2 Antibody

Product Images

WB Suggested Anti-MYEF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYEF2 antibody: synthetic peptide directed towards the N terminal of human MYEF2. Synthetic peptide located within the following region: PAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSKKANRFHPYS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: myelin expression factor 2
• Database Link:
  NP_057216
  Entrez Gene 50804 Human
  UniProt ID Q9P2K5
• Background: MYEF2 is the transcriptional repressor of the myelin basic protein gene (MBP). MYEF2 binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.
• Synonyms: HsT18564; MEF-2; MST156; MSTP156; myEF-2
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86%; Bovine: 86%; Dog: 77%

Reference Data

• Protein Families: Transcription Factors