Nmral1 Rabbit Polyclonal Antibody

CAT#: TA329936

Rabbit Polyclonal Anti-Nmral1 Antibody

Product Images

WB Suggested Anti-Nmral1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Nmral1 antibody: synthetic peptide directed towards the n terminal of mouse Nmral1. Synthetic peptide located within the following region: GATGAQGGSVARALLEDGTFRIRVVTRNPEQRAAKELKQQGAEVVRGDQD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: NmrA-like family domain containing 1
• Database Link:
  NP_080669
  Entrez Gene 67824 Mouse
  UniProt ID Q8K2T1
• Background: Nmral1 is a redox sensor protein. Nmral1 undergoes restructuring and subcellular redistribution in response to changes in intracellular NADPH/NADP+ levels. At low NADPH concentrations the protein is found mainly as a monomer, and binds argininosuccinate synthase (ASS1), the enzyme involved in nitric oxide synthesis. Association with ASS1 impairs its activity and reduces the production of nitric oxide, which subsecuently prevents apoptosis. Under normal NADPH concentrations, the protein is found as a dimer and hides the binding site for ASS1. The homodimer binds one molecule of NADPH.Nmral1 has higher affinity for NADPH than for NADP+. Binding to NADPH is necessary to form a stable dimer.
• Synonyms: FLJ25918; HSCARG; SDR48A1
• Note: Immunogen sequence homology: Mouse: 100%; Pig: 86%; Rat: 86%; Dog: 79%; Bovine: 79%