Taf7l Rabbit Polyclonal Antibody

CAT#: TA329954

Rabbit Polyclonal Anti-Taf7l Antibody

Product Images

Host: Rabbit; Target Name: Taf7l; Sample Tissue: Mouse Muscle lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Taf7l antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Taf7l. Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: TATA-box binding protein associated factor 7 like
• Database Link:
  NP_083234
  Entrez Gene 74469 Mouse
  UniProt ID Q9D3R9
• Background: Taf7l probably functions as a spermatogensis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. It may play a role in spermatogenesis.
• Synonyms: CT40; FLJ23157; TAF2Q
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 91%; Bovine: 82%; Pig: 75%