Taf7l Rabbit Polyclonal Antibody
Other products for "Taf7l"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TAF7L antibody: synthetic peptide directed towards the middle region of mouse TAF7L. Synthetic peptide located within the following region: DEDYGNEKEEEETDNSEEELEKELQAKFNEFSLHEADQDYSSITMAIQKL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 42 kDa |
Gene Name | TATA-box binding protein associated factor 7 like |
Database Link | |
Background | TAF7I belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs). |
Synonyms | CT40; FLJ23157; TAF2Q |
Note | Immunogen sequence homology: Mouse: 100%; Yeast: 100%; Rat: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.