RAB3A Rabbit Polyclonal Antibody

CAT#: TA330002

Rabbit Polyclonal Anti-RAB3A Antibody

Product Images

RAB3A antibody - C-terminal region validated by WB using Fetal Brain at 1.25 ug/ml.

• 

  RAB3A antibody - C-terminal region validated by WB using 1. Human Cervical Cancer Cell Lysate (15 ug); 2. Monkey Fibroblast Cell Lysate (15 ug); 3. Human Cervical Cancer Cell transfected with mouse Rab3A-GFP (15 ug) at 1:1000.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB3A antibody: synthetic peptide directed towards the C terminal of human RAB3A. Synthetic peptide located within the following region: NVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: RAB3A, member RAS oncogene family
• Database Link:
  NP_002857
  Entrez Gene 5864 Human
  UniProt ID P20336
• Background: RAB3A is involved in exocytosis by regulating a late step in synaptic vesicle fusion. It could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
• Synonyms: RAB3A
• Note: Immunogen sequence homology: Human: 100%; Bovine: 86%; Dog: 86%; Guinea pig: 86%; Mouse: 86%; Pig: 86%; Rat: 86%; Sheep: 86%; African clawed frog: 80%

Reference Data

• Protein Families: Druggable Genome