CHRNA1 Rabbit Polyclonal Antibody

CAT#: TA330009

Rabbit Polyclonal Anti-CHRNA1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CHRNA1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name cholinergic receptor nicotinic alpha 1 subunit
Background CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.
Synonyms ACHRA; ACHRD; CHRNA; CMS1A; CMS1B; CMS2A; FCCMS; SCCMS
Note Immunogen sequence homology: Dog: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Chicken: 86%; Guinea pig: 86%; Mouse: 80%
Reference Data
Protein Families Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.