TWEAK (TNFSF12) Rabbit Polyclonal Antibody

CAT#: TA330020

Rabbit Polyclonal Anti-TNFSF12 Antibody

Product Images

WB Suggested Anti-TNFSF12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: tumor necrosis factor superfamily member 12
• Database Link:
  NP_003800
  Entrez Gene 8742 Human
• Background: TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
• Synonyms: APO3L; DR3LG; TWEAK
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Mouse: 75%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction