PRDM1 Rabbit Polyclonal Antibody

CAT#: TA330023

Rabbit Polyclonal Anti-PRDM1 Antibody

Product Images

WB Suggested Anti-PRDM1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: SH-SYSY cell lysate

• 

  Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-PRDM1 antibody (P100596_P050)

• 

  Anti-BLIMP-1 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the middle region of human PRDM1. Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: PR domain 1
• Database Link:
  NP_878911
  Entrez Gene 639 Human
  UniProt ID O75626
• Background: PRDM1 is a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported.
• Synonyms: BLIMP1; PRDI-BF1
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Guinea pig: 84%

Reference Data

• Protein Families: Transcription Factors