MYPOP Rabbit Polyclonal Antibody

CAT#: TA330048

Rabbit Polyclonal Anti-MYPOP Antibody

Product Images

WB Suggested Anti-MYPOP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYPOP antibody: synthetic peptide directed towards the N terminal of human LOC339344. Synthetic peptide located within the following region: RTGQEVQKRWNDFKRRTKEKLARVPHSTQGAGPAAEDAFSAEEETIFAIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: Myb-related transcription factor, partner of profilin
• Database Link:
  NP_001012661
  Entrez Gene 339344 Human
  UniProt ID Q86VE0
• Background: LOC339344 is a transcriptional repressor; DNA-binding protein that specifically recognizes the core sequence 5'-YAAC[GT]G-3'. Dimerization with PFN1 reduces its DNA-binding capacity.
• Synonyms: P42pop
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; African clawed frog: 92%