GTF2H1 Rabbit Polyclonal Antibody

CAT#: TA330081

Rabbit Polyclonal Anti-GTF2H1 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GTF2H1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the N terminal of human GTF2H1. Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 62 kDa
Gene Name general transcription factor IIH subunit 1
Background Transcription Factor IIH, polypeptide 1.
Synonyms BTF2; P62; TFB1; TFIIH
Note Immunogen sequence homology: African clawed frog: 100%; Chicken: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 78%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Basal transcription factors, Nucleotide excision repair

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.