GTF2H1 Rabbit Polyclonal Antibody

CAT#: TA330081

Rabbit Polyclonal Anti-GTF2H1 Antibody

Product Images

WB Suggested Anti-GTF2H1 Antibody Titration: 1.0-2.0ug/ml; Positive Control: Daudi cell lysateGTF2H1 is supported by BioGPS gene expression data to be expressed in Daudi

• 

  Human kidney

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the N terminal of human GTF2H1. Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: general transcription factor IIH subunit 1
• Database Link:
  NP_005307
  Entrez Gene 14884 MouseEntrez Gene 2965 Human
  UniProt ID P32780
• Background: Transcription Factor IIH, polypeptide 1.
• Synonyms: BTF2; P62; TFB1; TFIIH
• Note: Immunogen sequence homology: African clawed frog: 100%; Chicken: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 78%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal transcription factors, Nucleotide excision repair