TFIIE alpha (GTF2E1) Rabbit Polyclonal Antibody

CAT#: TA330103

Rabbit Polyclonal Anti-GTF2E1 Antibody

Product Images

WB Suggested Anti-GTF2E1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysateGTF2E1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2E1 antibody: synthetic peptide directed towards the N terminal of human GTF2E1. Synthetic peptide located within the following region: DHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: general transcription factor IIE subunit 1
• Database Link:
  NP_005504
  Entrez Gene 2960 Human
  UniProt ID P29083
• Background: GTF2E1 belongs to the TFIIE alpha subunit family. It recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.
• Synonyms: FE; TF2E1; TFIIE-A
• Note: Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 92%; Rat: 92%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors