c-Jun (JUN) Rabbit Polyclonal Antibody

CAT#: TA330130

Rabbit Polyclonal Anti-JUN Antibody

Product Images

WB Suggested Anti-JUN Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293TJUN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

• 

  Rabbit Anti-JUN Antibody; Catalog Number: P100911; Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Chromatin Immunoprecipitation (ChIP) Using JUN antibody - N-terminal region (P100911_P050) and HCT116 Cells

Specifications

Product Data

• Applications: Assay, IHC, WB
• Recommended Dilution: WB, IHC, ChIP
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: Jun proto-oncogene, AP-1 transcription factor subunit
• Database Link:
  NP_002219
  Entrez Gene 3725 Human
  UniProt ID P05412
• Background: JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: AP-1; AP1; c-Jun
• Note: Immunogen sequence homology: Human: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Sheep: 92%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: B cell receptor signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, GnRH signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Renal cell carcinoma, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Wnt signaling pathway