HOXD10 Rabbit Polyclonal Antibody

CAT#: TA330143

Rabbit Polyclonal Anti-HOXD10 Antibody

Product Images

WB Suggested Anti-HOXD10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HOXD10 antibody: synthetic peptide directed towards the middle region of human HOXD10. Synthetic peptide located within the following region: NPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: homeobox D10
• Database Link:
  NP_002139
  Entrez Gene 3236 Human
  UniProt ID P28358
• Background: HOXD10 is the sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as 'rocker-bottom foot' deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: Hox-4.4; HOX4; HOX4D; HOX4E
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Horse: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 92%; African clawed frog: 76%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors