OTX1 Rabbit Polyclonal Antibody
Other products for "OTX1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the C terminal of human OTX1. Synthetic peptide located within the following region: SGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | orthodenticle homeobox 1 |
Database Link | |
Background | OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. |
Synonyms | FLJ38361; MGC15736 |
Note | Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.