PSMD6 Rabbit Polyclonal Antibody

CAT#: TA330284

Rabbit Polyclonal Anti-PSMD6 Antibody

Product Images

WB Suggested Anti-PSMD6 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: PLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: proteasome 26S subunit, non-ATPase 6
• Database Link:
  NP_055629
  Entrez Gene 9861 Human
  UniProt ID Q15008
• Background: PSMD6 acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
• Synonyms: p42A; p44S10; Rpn7; S10; SGA-113M
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Pathways: Proteasome