Gemin 7 (GEMIN7) Rabbit Polyclonal Antibody

CAT#: TA330296

Rabbit Polyclonal Anti-GEMIN7 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GEMIN7"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-GEMIN7 antibody is: synthetic peptide directed towards the N-terminal region of Human GEMIN7. Synthetic peptide located within the following region: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQES
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 14 kDa
Gene Name gem nuclear organelle associated protein 7
Background The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
Synonyms SIP3
Note Immunogen sequence homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 86%
Reference Data
Protein Families Stem cell - Pluripotency

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.