TRAIL (TNFSF10) Rabbit Polyclonal Antibody

CAT#: TA330336

Rabbit Polyclonal Anti-TNFSF10 Antibody

Product Images

WB Suggested Anti-TNFSF10 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TNFSF10 antibody: synthetic peptide directed towards the N terminal of human TNFSF10. Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: tumor necrosis factor superfamily member 10
• Database Link:
  NP_003801
  Entrez Gene 8743 Human
  UniProt ID P50591
• Background: TNFSF10 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3.
• Synonyms: Apo-2L; APO2L; CD253; TL2; TRAIL
• Note: Immunogen sequence homology: Human: 100%; Dog: 80%; Pig: 78%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Apoptosis, Cytokine-cytokine receptor interaction, Natural killer cell mediated cytotoxicity