CDK3 Rabbit Polyclonal Antibody

CAT#: TA330351

Rabbit Polyclonal Anti-CDK3 Antibody

Product Images

Lanes: 1: 40ug mouse heart lysate, 2: 40ug mouse heart lysate; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1:10000; Gene Name: CDK3; Submitted by: Anonymous;

• 

  WB Suggested Anti-CDK3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDK3 antibody: synthetic peptide directed towards the C terminal of human CDK3. Synthetic peptide located within the following region: NLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: cyclin-dependent kinase 3
• Database Link:
  NP_001249
  Entrez Gene 1018 Human
  UniProt ID Q00526
• Background: CDK3 is a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0.This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: cyclin-dependent kinase 3
• Note: Immunogen sequence homology: Human: 100%; Mouse: 93%; Rabbit: 87%; Dog: 86%; Bovine: 81%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase