PCTAIRE3 (CDK18) Rabbit Polyclonal Antibody

CAT#: TA330356

Rabbit Polyclonal Anti-CDK18 Antibody

Product Images

WB Suggested Anti-PCTK3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PCTK3 antibody: synthetic peptide directed towards the N terminal of human PCTK3. Synthetic peptide located within the following region: IMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: cyclin-dependent kinase 18
• Database Link:
  NP_997668
  Entrez Gene 5129 Human
  UniProt ID Q07002
• Background: PCTK3 belongs to the protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily. PCTK3 contains 1 protein kinase domain. It may play a role in signal transduction cascades in terminally differentiated cells.
• Synonyms: PCTAIRE; PCTAIRE3; PCTK3
• Note: Immunogen sequence homology: Bovine:100%; Chicken:100%; Green puffer:100%; Sumatran orangutan:100%; Human:100%; Rat:92%; Mouse:92%; Western clawed frog:91%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase