Cyclin H (CCNH) Rabbit Polyclonal Antibody

CAT#: TA330360

Rabbit Polyclonal Anti-CCNH Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CCNH"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CCNH antibody: synthetic peptide directed towards the C terminal of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name cyclin H
Background Cyclin H regulates CDK7, the catalytic subunit of the CDK- activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDC2/CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive carboxyl-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. It is involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.
Synonyms CAK; CycH; p34; p37
Note Immunogen sequence homology: Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Mouse: 83%; Rabbit: 83%; Rat: 83%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Cell cycle, Nucleotide excision repair

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.