Cyclin H (CCNH) Rabbit Polyclonal Antibody

CAT#: TA330360

Rabbit Polyclonal Anti-CCNH Antibody

Product Images

WB Suggested Anti-CCNH Antibody Titration: 1ug/ml; Positive Control: Jurkat cell lysateCCNH is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCNH antibody: synthetic peptide directed towards the C terminal of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: cyclin H
• Database Link:
  NP_001230
  Entrez Gene 902 Human
  UniProt ID P51946
• Background: Cyclin H regulates CDK7, the catalytic subunit of the CDK- activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDC2/CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive carboxyl-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. It is involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.
• Synonyms: CAK; CycH; p34; p37
• Note: Immunogen sequence homology: Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Mouse: 83%; Rabbit: 83%; Rat: 83%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Cell cycle, Nucleotide excision repair