GABA A Receptor delta (GABRD) Rabbit Polyclonal Antibody

CAT#: TA330436

Rabbit Polyclonal Anti-GABRD Antibody

Product Images

WB Suggested Anti-GABRD Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Muscle

• 

  Sample Type : Rat brain sectionPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-biotin, streptavidin-diaminobenzidineSecondary Antibody Dilution : 1:500Gene Name : GABRDSubmitted by : Dr. Amiel Rosenkranz, Rosalind Franklin University

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: gamma-aminobutyric acid type A receptor delta subunit
• Database Link:
  NP_000806
  Entrez Gene 29689 RatEntrez Gene 2563 Human
  UniProt ID O14764
• Background: Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. The GABRD gene encodes the delta subunit.Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. This gene encodes the delta subunit.
• Synonyms: EIG10; EJM7; GEFSP5
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Chicken: 76%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction