LNX1 Rabbit Polyclonal Antibody

CAT#: TA330487

Rabbit Polyclonal Anti-LNX1 Antibody

Product Images

WB Suggested Anti-LNX1 Antibody Titration: 1.25 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LNX1 antibody: synthetic peptide directed towards the C terminal of human LNX1. Synthetic peptide located within the following region: SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: ligand of numb-protein X 1
• Database Link:
  NP_116011
  Entrez Gene 84708 Human
  UniProt ID Q8TBB1
• Background: LNX1 is a membrane-bound protein that is involved in signal transduction and protein interactions. LNX1 is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis.This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene.
• Synonyms: LNX; MPDZ; PDZRN2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome