TRIM58 Rabbit Polyclonal Antibody

CAT#: TA330516

Rabbit Polyclonal Anti-TRIM60 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TRIM58"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRIM60 antibody: synthetic peptide directed towards the N terminal of human TRIM60. Synthetic peptide located within the following region: LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 55 kDa
Gene Name tripartite motif containing 58
Background TRIM60 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1842 AK093201.1 2-1843
Synonyms BIA2
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.