PSMD14 Rabbit Polyclonal Antibody

CAT#: TA330546

Rabbit Polyclonal Anti-PSMD14 Antibody

Product Images

Lanes: ; 1. 100 ug HeLa cell lysate; 2. 100 ug mouse liver cytosolic extract 3. 1.5 ug human 26S Proteasome; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Anti-Rabbit AP; Secondary Antibody Dilution: ; 1:10000; Gene Name: ; PSMD14; Submitted

• 

  WB Suggested Anti-PSMD14 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysatePSMD14 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the C terminal of human PSMD14. Synthetic peptide located within the following region: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: proteasome 26S subunit, non-ATPase 14
• Database Link:
  NP_005796
  Entrez Gene 59029 MouseEntrez Gene 10213 Human
  UniProt ID O00487
• Background: POH1 (pad one homolog-1) is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway
• Synonyms: PAD1; POH1; RPN11
• Note: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome