PSMD14 Rabbit Polyclonal Antibody

CAT#: TA330547

Rabbit Polyclonal Anti-PSMD14 Antibody

Product Images

WB Suggested Anti-PSMD14 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysatePSMD14 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Rabbit Anti-PSMD14 antibody; Paraffin Embedded Tissue: Human Lung cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the N terminal of human PSMD14. Synthetic peptide located within the following region: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: proteasome 26S subunit, non-ATPase 14
• Database Link:
  NP_005796
  Entrez Gene 59029 MouseEntrez Gene 10213 Human
  UniProt ID O00487
• Background: POH1 (pad one homolog-1) is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).
• Synonyms: PAD1; POH1; RPN11
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome