SIRT4 Rabbit Polyclonal Antibody

CAT#: TA330548

Rabbit Polyclonal Anti-SIRT4 Antibody

Product Images

WB Suggested Anti-SIRT4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

• 

  Host: Rabbit; Target Name: SIRT4; Sample Tissue: MCF7; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1ug/ml; Peptide Concentration: 5ug/ml; Lysate Quantity: 25ug/lane/lane; Gel Concentration: 0.12

• 

  Pancreas

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIRT4 antibody: synthetic peptide directed towards the middle region of human SIRT4. Synthetic peptide located within the following region: QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: sirtuin 4
• Database Link:
  NP_036372
  Entrez Gene 23409 Human
  UniProt ID Q9Y6E7
• Background: SIRT4 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT4 is included in class IV of the sirtuin family.This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.
• Synonyms: SIR2L4
• Note: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Sheep: 92%; Pig: 86%; Dog: 79%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors