Steroidogenic Factor 1 (NR5A1) Rabbit Polyclonal Antibody

CAT#: TA330584

Rabbit Polyclonal Anti-NR5A1 Antibody

Product Images

WB Suggested Anti-NR5A1 Antibody Titration: 20ug/ml; Positive Control: Daudi cell lysateNR5A1 is supported by BioGPS gene expression data to be expressed in Daudi

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: PGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: nuclear receptor subfamily 5 group A member 1
• Database Link:
  NP_004950
  Entrez Gene 2516 Human
  UniProt ID Q13285
• Background: NR5A1 is a members of the orphan nuclear receptor superfamily that is critical regulatory components of the hypothalamic-pituitary-adrenal-gonadal axis. In adrenal and gonadal tissues they regulate the expression of the cytochrome P450 steroid hydroxylase genes, key mediators of steroidogenesis.
• Synonyms: AD4BP; ELP; FTZ1; FTZF1; hSF-1; POF7; SF-1; SF1; SPGF8; SRXY3
• Note: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors