DAP13 (NDUFA12) Rabbit Polyclonal Antibody

CAT#: TA330695

Rabbit Polyclonal Anti-NDUFA12 Antibody

Product Images

Host: Rabbit; Target Name: NDUFA12; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NDUFA12 antibody is: synthetic peptide directed towards the N-terminal region of Human NDUFA12. Synthetic peptide located within the following region: VLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: NADH:ubiquinone oxidoreductase subunit A12
• Database Link:
  NP_061326
  Entrez Gene 55967 Human
  UniProt ID Q9UI09
• Background: This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants.
• Synonyms: B17.2; DAP13
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 91%