Germany
Japan
United Kingdom
China
RGD1306739 Rabbit Polyclonal Antibody
Product Images
Other products for "Cabcoco1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Rat |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-RGD1306739 antibody is: synthetic peptide directed towards the C-terminal region of Rat RGD1306739. Synthetic peptide located within the following region: PLGGFTIDDVKLALARVTDEVLISIQNEINEKLQVQEESFNARIEKLKKA |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 34 kDa |
| Gene Name | similar to RIKEN cDNA 1700040L02 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | RGD1306739 |
| Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.