LYK5 (STRADA) Rabbit Polyclonal Antibody

CAT#: TA330987

Rabbit polyclonal Anti-LYK5 Antibody

Product Images

WB Suggested Anti-LYK5 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate.STRADA is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: STRADA; Sample Tissue: 721_B; Antibody Dilution: 1.0ug/ml; STRADA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LYK5 antibody: synthetic peptide directed towards the C terminal of human LYK5. Synthetic peptide located within the following region: AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: STE20-related kinase adaptor alpha
• Database Link:
  NP_001003787
  Entrez Gene 92335 Human
  UniProt ID Q7RTN6
• Background: LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11. It relocates STK11 from the nucleus to the cytoplasm and plays an essential role in STK11-mediated G1 cell cycle arrest.
• Synonyms: LYK5; NY-BR-96; PMSE; Stlk; STRAD
• Note: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: mTOR signaling pathway