TMEM126B Rabbit Polyclonal Antibody

CAT#: TA331045

Rabbit polyclonal Anti-TMEM126B Antibody

Product Images

WB Suggested Anti-TMEM126B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate; TMEM126B is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM126B antibody: synthetic peptide directed towards the N terminal of human TMEM126B. Synthetic peptide located within the following region: AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: transmembrane protein 126B
• Database Link:
  NP_060950
  Entrez Gene 55863 Human
  UniProt ID Q8IUX1
• Background: It belongs to the TMEM126 family. The function remains unknown.
• Synonyms: HT007
• Note: Human: 100%; Rabbit: 92%; Dog: 86%

Reference Data

• Protein Families: Transmembrane