TMEM126B Rabbit Polyclonal Antibody

CAT#: TA331046

Rabbit polyclonal Anti-TMEM126B Antibody

Product Images

WB Suggested Anti-TMEM126B Antibody Titration: 1.25ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM126B antibody: synthetic peptide directed towards the middle region of human TMEM126B. Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: transmembrane protein 126B
• Database Link:
  NP_060950
  Entrez Gene 55863 Human
  UniProt ID Q8IUX1
• Background: The function remains unknown.
• Synonyms: HT007
• Note: Human: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Dog: 92%; Bovine: 92%; Rat: 86%; Mouse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane